Product Info Summary
SKU: | PB9398 |
---|---|
Size: | 100 μg/vial |
Reactive Species: | Human, Mouse, Rat |
Host: | Rabbit |
Application: | Flow Cytometry, IF, IHC, ICC, WB |
Customers Who Bought This Also Bought
Product info
Product Name
Anti-SMN1/2 Antibody Picoband™
SKU/Catalog Number
PB9398
Size
100 μg/vial
Form
Lyophilized
Description
Boster Bio Anti-SMN1/2 Antibody Picoband™ catalog # PB9398. Tested in Flow Cytometry, IF, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.
Storage & Handling
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Cite This Product
Anti-SMN1/2 Antibody Picoband™ (Boster Biological Technology, Pleasanton CA, USA, Catalog # PB9398)
Host
Rabbit
Contents
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Clonality
Polyclonal
Isotype
Rabbit IgG
Immunogen
A synthetic peptide corresponding to a sequence at the N-terminus of human SMN1/2, identical to the related mouse and rat sequences.
*Blocking peptide can be purchased. Costs vary based on immunogen length. Contact us for pricing.
Cross-reactivity
No cross-reactivity with other proteins.
Reactive Species
PB9398 is reactive to SMN1 in Human, Mouse, Rat
Applications
PB9398 is guaranteed for Flow Cytometry, IF, IHC, ICC, WB Boster Guarantee
Observed Molecular Weight
32 kDa
Calculated molecular weight
31.849kDa
Background of SMN
This gene is part of a 500 kb inverted duplication on chromosome 5q13. This duplicated region contains at least four genes and repetitive elements which make it prone to rearrangements and deletions. The repetitiveness and complexity of the sequence have also caused difficulty in determining the organization of this genomic region. The telomeric and centromeric copies of this gene are nearly identical and encode the same protein. However, mutations in this gene, the telomeric copy, are associated with spinal muscular atrophy; mutations in the centromeric copy do not lead to disease. The centromeric copy may be a modifier of disease caused by mutation in the telomeric copy. The critical sequence difference between the two genes is a single nucleotide in exon 7, which is thought to be an exon splice enhancer. Note that the nine exons of both the telomeric and centromeric copies are designated historically as exon 1, 2a, 2b, and 3-8. It is thought that gene conversion events may involve the two genes, leading to varying copy numbers of each gene. The protein encoded by this gene localizes to both the cytoplasm and the nucleus. Within the nucleus, the protein localizes to subnuclear bodies called gems which are found near coiled bodies containing high concentrations of small ribonucleoproteins (snRNPs). This protein forms heteromeric complexes with proteins such as SIP1 and GEMIN4, and also interacts with several proteins known to be involved in the biogenesis of snRNPs, such as hnRNP U protein and the small nucleolar RNA binding protein. Multiple transcript variants encoding distinct isoforms have been described.
Antibody Validation
Boster validates all antibodies on WB, IHC, ICC, Immunofluorescence, and ELISA with known positive control and negative samples to ensure specificity and high affinity, including thorough antibody incubations.
Innovating Scientists Reward
If you are the first to review this product, or if you have results for a special sample, species or application this product is not validated in, share your results with us and receive product credits you can use towards any Boster products! Applicable to all scientists worldwide.
Submit A Review
Assay dilution & Images
Reconsitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Assay Dilutions Recommendation
The recommendations below provide a starting point for assay optimization. The actual working concentration varies and should be decided by the user.
Western blot, 0.1-0.5μg/ml, Human, Mouse, Rat
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml, Human, Mouse, Rat, By Heat
Immunocytochemistry/Immunofluorescence, 2μg/ml, Human
Flow Cytometry, 1-3μg/1x106 cells, Human
Validation Images & Assay Conditions
Click image to see more details
Anti-SMN1/2 Picoband antibody, PB9398,IHC(P)
IHC(P): Mouse Brain Tissue
Click image to see more details
Anti-SMN1/2 Picoband antibody, PB9398, Western blotting
All lanes: Anti SMN1/2(PB9398) at 0.5ug/ml
Lane 1: Rat Brain Tissue Lysate at 50ug
Lane 2: Mouse Brain Tissue Lysate at 50ug
Lane 3: Rat Liver Tissue Lysate at 50ug
Lane 4: Mouse Liver Tissue Lysate at 50ug
Lane 5: 293T Whole Cell Lysate at 40ug
Lane 6: SMMC Whole Cell Lysate at 40ug
Lane 7: HEPG2 Whole Cell Lysate at 40ug
Lane 8: HELA Whole Cell Lysate at 40ug
Predicted bind size: 32KD
Observed bind size: 32KD
Click image to see more details
Anti-SMN1/2 Picoband antibody, PB9398,IHC(P)
IHC(P): Rat Brain Tissue
Click image to see more details
Anti-SMN1/2 Picoband antibody, PB9398,IHC(P)
IHC(P): Human Mammary Cancer Tissue
Click image to see more details
Figure 5. IF analysis of SMN1/2 using anti-SMN1/2 antibody (PB9398).
SMN1/2 was detected in immunocytochemical section of U20S cells. Enzyme antigen retrieval was performed using IHC enzyme antigen retrieval reagent (AR0022) for 15 mins. The cells were blocked with 10% goat serum. And then incubated with 2μg/mL rabbit anti-SMN1/2 Antibody (PB9398) overnight at 4°C. DyLight®488 Conjugated Goat Anti-Rabbit IgG (BA1127) was used as secondary antibody at 1:100 dilution and incubated for 30 minutes at 37°C. The section was counterstained with DAPI. Visualize using a fluorescence microscope and filter sets appropriate for the label used.
Click image to see more details
Figure 6. Flow Cytometry analysis of A431 cells using anti-SMN1/2 antibody (PB9398).
Overlay histogram showing A431 cells stained with PB9398 (Blue line).The cells were blocked with 10% normal goat serum. And then incubated with rabbit anti-SMN1/2 Antibody (PB9398,1μg/1x106 cells) for 30 min at 20°C. DyLight®488 conjugated goat anti-rabbit IgG (BA1127, 5-10μg/1x106 cells) was used as secondary antibody for 30 minutes at 20°C. Isotype control antibody (Green line) was rabbit IgG (1μg/1x106) used under the same conditions. Unlabelled sample (Red line) was also used as a control.
Protein Target Info & Infographic
Gene/Protein Information For SMN1 (Source: Uniprot.org, NCBI)
Gene Name
SMN1
Full Name
Survival motor neuron protein
Weight
31.849kDa
Superfamily
SMN family
Alternative Names
Gemin-1; Kugelberg-Welander disease); SMNC; survival motor neuron protein; survival of motor neuron 1, telomeric SMN1 BCD541, GEMIN1, SMA, SMA1, SMA2, SMA3, SMA4, SMA@, SMN, SMNT, T-BCD541, TDRD16A survival of motor neuron 1, telomeric survival motor neuron protein|component of gems 1|gemin-1|survival motor neuron 1 protein|tudor domain containing 16A
*If product is indicated to react with multiple species, protein info is based on the gene entry specified above in "Species".For more info on SMN1, check out the SMN1 Infographic
We have 30,000+ of these available, one for each gene! Check them out.
In this infographic, you will see the following information for SMN1: database IDs, superfamily, protein function, synonyms, molecular weight, chromosomal locations, tissues of expression, subcellular locations, post-translational modifications, and related diseases, research areas & pathways. If you want to see more information included, or would like to contribute to it and be acknowledged, please contact [email protected].
Specific Publications For Anti-SMN1/2 Antibody Picoband™ (PB9398)
Hello CJ!
No publications found for PB9398
*Do you have publications using this product? Share with us and receive a reward. Ask us for more details.
Recommended Resources
Here are featured tools and databases that you might find useful.
- Boster's Pathways Library
- Protein Databases
- Bioscience Research Protocol Resources
- Data Processing & Analysis Software
- Photo Editing Software
- Scientific Literature Resources
- Research Paper Management Tools
- Molecular Biology Software
- Primer Design Tools
- Bioinformatics Tools
- Phylogenetic Tree Analysis
Customer Reviews
Have you used Anti-SMN1/2 Antibody Picoband™?
Submit a review and receive an Amazon gift card.
- $30 for a review with an image
Be the first to review Anti-SMN1/2 Antibody Picoband™
*The first user to submit a review for a product is eligible for Boster's Innovating Scientists Reward, which gives product credits. This is in addition to the gift card reward.
Customer Q&As
Have a question?
Find answers in Q&As, reviews.
Can't find your answer?
Submit your question
4 Customer Q&As for Anti-SMN1/2 Antibody Picoband™
Question
We are currently using anti-SMN1/2 antibody PB9398 for mouse tissue, and we are happy with the WB results. The species of reactivity given in the datasheet says human, mouse, rat. Is it likely that the antibody can work on canine tissues as well?
Verified Customer
Verified customer
Asked: 2019-07-16
Answer
The anti-SMN1/2 antibody (PB9398) has not been validated for cross reactivity specifically with canine tissues, though there is a good chance of cross reactivity. We have an innovator award program that if you test this antibody and show it works in canine you can get your next antibody for free. Please contact me if I can help you with anything.
Boster Scientific Support
Answered: 2019-07-16
Question
Is this PB9398 anti-SMN1/2 antibody reactive to the isotypes of SMN1?
Verified Customer
Verified customer
Asked: 2019-05-31
Answer
The immunogen of PB9398 anti-SMN1/2 antibody is A synthetic peptide corresponding to a sequence at the N-terminus of human SMN1/2(22-52aa RRGTGQSDDSDIWDDTALIKAYDKAVASFKH), identical to the related mouse and rat sequences. Could you tell me which isotype you are interested in so I can help see if the immunogen is part of this isotype?
Boster Scientific Support
Answered: 2019-05-31
Question
I have a question about product PB9398, anti-SMN1/2 antibody. I was wondering if it would be possible to conjugate this antibody with biotin. I would need it to be without BSA or sodium azide. I am planning on using a buffer exchange of sodium azide with PBS only. Would there be problems for me to conjugate the antibody and store it in -20 degrees in small aliquots?
A. Parker
Verified customer
Asked: 2014-06-16
Answer
It is not recommended storing this antibody with PBS buffer only in -20 degrees. If you want to store it in -20 degrees it is best to add some cryoprotectant like glycerol. If you want carrier free PB9398 anti-SMN1/2 antibody, we can provide it to you in a special formula with trehalose and/or glycerol. These molecules will not interfere with conjugation chemistry and provide a good level of protection for the antibody from degradation. Please be sure to specify this in your purchase order.
Boster Scientific Support
Answered: 2014-06-16
Question
Would anti-SMN1/2 antibody PB9398 work on monkey IHC with liver?
D. Collins
Verified customer
Asked: 2013-04-02
Answer
Our lab technicians have not tested anti-SMN1/2 antibody PB9398 on monkey. You can run a BLAST between monkey and the immunogen sequence of anti-SMN1/2 antibody PB9398 to see if they may cross-react. If the sequence homology is close, then you can perform a pilot test. Keep in mind that since we have not validated monkey samples, this use of the antibody is not covered by our guarantee. However we have an innovator award program that if you test this antibody and show it works in monkey liver in IHC, you can get your next antibody for free.
Boster Scientific Support
Answered: 2013-04-02